Apurinic apyrimidinic endonuclease 1/Redox factor-1 (APE1/Ref-1) is a multifunctional protein; its N-terminal region is involved in redox activity and regulates multiple transcription factors, and its C-terminus is involved in base excision DNA repair activity. APE1/Ref-1 is mainly localized in the nucleus and shows dynamic shuttling between the nucleus and cytoplasm in response to various stress stimuli. Recently, it have a reported the possibility for the extracellular secretion of APE1/Ref-1. Elevated level of APE1/Ref-1 were observed in the blood of endotoxemic rats, and in bladder cancer.
Protein Gene name | APEX1 |
---|---|
Other name | APE1, Ref-1, APE1/Ref-1 |
NCBI Reference Sequence | NM_001641.3 |
Cat.No | MR-RPAPE-*** |
AA Sequence |
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPNSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPLYED PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLS RQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNP KGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDH CPITLYLAL |
Size | 0.05, 0.1, 0.5, 1 mg/ml |
Host | E. Coli |
Form/ storage solution | Solution, containing 10mM Tris-HClpH8, 50mM Nacl, 1mM DTT, 0.05mM EDTA, 200 µg/ml BSA, 50% glycerol |
Concentration | 1mg/ml |
Protein Form | Full Length, Recombinant |
Protein Tag or Fusion | N-terminal His tag |
Protein size | 39 kDa |
Purity | ≥ 95% by SDS-PAGE |
Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles |
Protein | Host | Protein Tag or Fusion | Endotoxin | Size | Cat No. |
Price(₩) (VAT 별도) |
Standard protein For APE1/Ref-1 ELISA | E.coli | His | - | 0.01㎎ | MR-RPAPE-001 | ₩120,000 |
APE1/Ref-1 protein, Human, Recombinant | E.coli | His | - | 0.1㎎ | MR-RPAPE-010 | ₩450,000 |
APE1/Ref-1 protein, Human, Recombinant | E.coli | His | <1EU/㎍ | 0.1㎎ | MR-EAPE-100 | ₩612,000 |
Recombinant APE1/Ref-1 Fc Fusion protein | E.coli | His | <1EU/㎍ | 0.1㎎ | MR-EFAPE-100 | ₩660,000 |